Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_2555_f_1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family VOZ
Protein Properties Length: 482aa    MW: 54324.4 Da    PI: 7.0539
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_2555_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
            VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf 96 
                    pppsaf+gpkcalwdctrpa g+ew++dycssfhatla++e++pg++pvlrp+gi+lkd+llf+a++ak+qgk+vgip+cegaat+k+pwna+e+f
                    89********************************************************************************************** PP

            VOZ  97 dlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvde 192
                    d+sll+getirewlffdk rrafesg rkqrslpd+ grgwhesrkqvmke+gg+krsyymdpqps+ fewhlyeye+n +d++alyrlelk++ +
                    ************************************************************************************************ PP

            VOZ 193 kksakgkvskdsladlqkklgrlta 217
                    kks+kgk +kdsladlqkk+g+lta
                    ***********************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006469061.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-171VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A067DW120.0A0A067DW12_CITSI; Uncharacterized protein
STRINGVIT_12s0028g02670.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-160vascular plant one zinc finger protein